peptides9000.com › Topic › Background And Composition — What the Evidence Shows

Background And Composition — What the Evidence Shows

By Editorial Desk · published 2025-08-17 · last reviewed 2025-10-06 · Topic

If you have been reading about Whey protein and want a single page that covers the useful parts, this is it: definitions, context, how it is studied, and the questions that come up repeatedly.

Updated 2025-10-06. Numbers and descriptions here follow the published literature rather than marketing material.

Background and Composition

Whey protein hydrolysate is a dairy ingredient produced when whey proteins are treated with proteolytic enzymes or, less commonly, acid or heat under controlled conditions. The treatment cleaves peptide bonds and yields shorter peptide chains than those found in intact whey protein. The starting material is usually sweet whey or acid whey from cheese manufacture, concentrated by membrane filtration before hydrolysis. The resulting ingredient retains many amino acids from the original protein but differs in molecular size, solubility, and taste profile.

The parent whey proteins include beta-lactoglobulin, alpha-lactalbumin, serum albumin, immunoglobulins, and glycomacropeptide, depending on the whey source. Hydrolysis does not remove these sequences; it fragments them into peptides of varying length. The peptide distribution depends on the enzyme specificity, reaction time, temperature, pH, and enzyme-to-substrate ratio. Because the mixture is heterogeneous, a single molecular weight cannot describe the product. Instead, laboratories report a distribution, often spanning from a few hundred to several thousand daltons.

Analytical Characterization and Stability

Routine quality control for hydrolysate powders includes total nitrogen or protein content by Kjeldahl or Dumas combustion, moisture by oven or Karl Fischer titration, ash, and mineral profiles. Microbiological tests typically cover total aerobic counts, yeasts, molds, and specified pathogens according to regional food safety rules. Amino acid analysis can quantify free amino acids and peptide-bound residues after hydrolysis. For products intended for special populations, additional tests may target residual lactose, fat, or specific allergenic proteins. Specifications are set by the manufacturer and may exceed general food-grade requirements.

Hydrolysate powders are hygroscopic and can absorb moisture during storage, which may promote caking, browning, and loss of solubility. Cool, dry conditions and sealed packaging slow these changes, while high humidity and warm temperatures accelerate Maillard reactions between peptides and residual sugars. Liquid hydrolysates are more perishable and often require refrigeration or preservatives. Shelf-life studies usually monitor moisture, color, solubility, free amino groups, and microbial load over time. Stability depends on residual lactose, water activity, packaging barrier properties, and the initial peptide profile.

Whey-protein-hydrolysate at a glance

PropertyValueNotes
Common synonymsWhey hydrolysate; hydrolyzed whey proteinAbbreviations such as WPH appear in ingredient lists
AppearanceOff-white to light cream powderColor can vary with starting whey and drying method
Solubility classHighly soluble in waterShort peptides often dissolve more readily than intact whey protein
Typical storage temperature15–25 °CCool, dry conditions limit moisture uptake and browning reactions
Typical analytical methodSize-exclusion chromatographyUsed to estimate molecular weight distribution of peptides

Background and Production of Whey Hydrolysate

Whey protein hydrolysate appears in foods, infant formula, sports nutrition, and specialized clinical nutrition. Its production can reduce viscosity and improve heat stability compared with intact whey protein. Bitterness is common because short hydrophobic peptides can activate bitter taste receptors. The ingredient is not the same as free amino acids; it remains a mixture of peptides of different lengths. Composition varies by supplier, enzyme, and process, so two hydrolysates with the same protein content may behave differently in a formulation.

Whey protein hydrolysate is a dairy ingredient made by treating whey protein with enzymes or, less often, acid or heat to break peptide bonds. The starting material is typically sweet whey or acid whey from cheese making, first concentrated and dried into whey protein concentrate or isolate. Hydrolysis shortens long protein chains into smaller peptides, changing functional properties such as solubility, viscosity, and foam formation. The resulting powder contains peptides, residual intact protein, moisture, minerals, and variable amounts of lactose and fat depending on the starting material.

Enzymatic hydrolysis usually uses proteases from microbial, plant, or animal sources. The enzyme choice, pH, temperature, and reaction time determine which peptide bonds are cleaved and the final peptide profile. After hydrolysis, the enzyme is inactivated by heat, and the mixture is clarified, filtered, concentrated, and spray-dried. Manufacturers may use ultrafiltration to remove larger peptides or minerals. The degree of hydrolysis, often reported as a percentage, describes the proportion of peptide bonds broken. A higher degree generally means shorter peptides, but it does not by itself define taste, allergenicity, or biological activity.

Related pages on this site

Production and Quality Control

Hydrolysates are generally stable as dry powders but can absorb moisture and undergo browning during warm storage. The bitter taste of some hydrolysates arises from hydrophobic peptides exposed by cleavage, and it varies with enzyme choice and degree of hydrolysis. Reduced allergenicity is sometimes claimed, but residual IgE-binding peptides may remain, especially in partial hydrolysates. Regulatory frameworks treat extensively hydrolyzed and partially hydrolyzed products differently, and labeling rules vary by country. More research is needed on how specific peptide profiles relate to clinical outcomes.

Commercial production begins with whey protein concentrate or isolate dissolved in water. A protease is added under controlled pH and temperature, and the reaction is stopped by heat or pH adjustment once a target degree of hydrolysis is reached. Membrane filtration, often ultrafiltration or diafiltration, removes enzymes and small solutes while retaining peptides. The liquid is then concentrated and spray-dried into a powder. Each step influences peptide length, mineral content, and flavor.

Notes from published material

Akt resides in the cytosol in an inactive conformation, until the cell is stimulated and it translocates to the plasma membrane. The Akt PH domain has a high affinity for second messenger PI(3,4,5)P3, binding to it preferentially over other phosphoinositides. Thus PI3K activity is essential for translocation of Akt to the membrane. Interaction with PI(3,4,5)P3 causes conformational changes and exposure of phosphorylation sites Thr308 in the kinase domain and Ser473 in the C-terminal domain. Akt is partially activated by phosphorylation of T308 by PDK1. Full activation requires phosphorylation of S473, which can be catalysed by multiple proteins, including phosphoinositide-dependent kinase 2 (PDK2), integrin-linked kinase (ILK), mechanistic target of rapamycin complex complex 2 (mTORC2) and DNA-dependent protein kinase (DNA-PK). The regulation of Ser473 phosphorylation is not fully understood but may also be influenced by autophosphorylation after Thr308 phosphorylation. After stimulation, the levels of PIP3 decrease and Akt activity is attenuated by dephosphorylation by serine/threonine phosphatases.

In its oxidized form, azurin (Cu2+Az) receives an electron from its redox partner and is reduced according to the following reaction: Cu2+Az + e− → Cu+Az The redox potential is 310 mV. The highly interconnected beta-sheet structure of azurin is strongly coupled with its electron-transfer center (the copper-binding side). Considerable experimental evidence exists to suggest that hydrogen bonds play a role in the long-distance electron transfer mechanism of azurin. Taken together, these observations suggest that electrons tunnel through the protein along its polypeptide and hydrogen bonds, making azurin a useful model system for studying long-range, intraprotein electron transfer (LRET).

Adrenomedullin (ADM) is a peptide hormone that plays an important role in various physiological processes throughout the human body. Initially discovered in 1993 from a pheochromocytoma, a tumor of the adrenal medulla, this 52-amino acid peptide is now recognized for its diverse effects, including vasodilation, regulation of blood pressure, and maintenance of the vascular system. ADM is widely expressed in tissues and also found in the circulation, exerting its influence on the cardiovascular, lymphatic, and endocrine systems, as well as demonstrating anti-inflammatory and tissue-protective properties. In humans, ADM is encoded by the ADM gene. A similar peptide named adreomedullin2 was reported in rats in 2004, which exhibits a similar function.

Pandey has the Human Proteome Organization(HUPO)'s Discovery in Proteomic Sciences Award. The Wellcome Trust/DBT India Alliance named him a Margdarshi Fellow, and he established a Center for Molecular Medicine at NIMHANS in Bangalore as a result. He is an Associate Editor of Clinical Proteomics and a member of the Editorial Boards of Molecular and Cellular Proteomics, Proteomics, and the Journal of Clinical Investigation. He has received the Howard Temin Award from the National Cancer Institute, the Experimental Pathologist-In-Training Award from the American Society for Investigative Pathology, and the Sidney Kimmel Scholar Award from the Sidney Kimmel Foundation for Cancer Research. The United States Department of Defense also bestowed upon him the Era of Hope Scholar Award.

Sources: en.wikipedia.org

Further detail

AAV is of particular interest to gene therapists due to its apparent limited capacity to induce immune responses in humans, a factor which should positively influence vector transduction efficiency while reducing the risk of any immune-associated pathology. AAV is not considered to have any known role in disease. However, host immune system response and immune tolerance reduce the efficacy of AAV-mediated gene therapy. Host immune response has been shown to respond to the AAV vectors, the transduced cells, and the transduced proteins. The immune response can be subdivided into two categories: innate and adaptive, the latter of which is divided into humoral and cell-mediated.

Sedimentation equilibrium experiments reports the molar mass of analytes and their chemical equilibrium constants. The rotor speed is adjusted such that a steady-state concentration profile c(r) of the sample in the cell is formed, where sedimentation and diffusion cancel out each other. Ultracentrifuge Gas centrifuge Theodor Svedberg Differential centrifugation Buoyant density ultracentrifugation Zippe-type centrifuge Reversible Associations in Structural and Molecular Biology (RASMB -an Analytical Ultracentrifugation Forum) Analytical Ultracentrifugation as a Contemporary Biomolecular Research Tool. Archived 2002-08-04 at the Wayback Machine Gilbert-Jenkins theory Archived 2007-05-01 at the Wayback Machine Report on an ultracentrifuge explosion.

Advanced product quality planning is a process developed in the late 1980s by a commission of experts who gathered around the 'Big Three' of the US automobile industry: Ford, GM, and Chrysler. Representatives from the three automotive original equipment manufacturers (OEMs) and the Automotive Division of American Society for Quality Control (ASQC) created the Supplier Quality Requirement Task Force for developing a common understanding on topics of mutual interest within the automotive industry. This commission worked five years to analyze the then-current automotive development and production status in the US, Europe, and especially in Japan. At the time, the Japanese automotive companies were successful in the US market. APQP is utilized by US automakers and some of their affiliates. Tier 1 suppliers are typically required to follow APQP procedures, techniques, and are also typically required to be audited and registered to IATF 16949. This methodology is also being used in other manufacturing sectors. The Automotive Industry Action Group (AIAG) is a non-profit association of automotive companies founded in 1982. The basis for the process control plan is described in AIAG's APQP manual These include:

Banting House features archival materials, artifacts, and other ephemera associated with Banting as co-discoverer of insulin, doctor, and artist, as well as his involvement in the first and second world wars. One gallery depicts the kind of office Banting might have had, and contains several of his belongings, including his original medicine cabinet, and a graduated cylinder Banting used during his time at the University of Western Ontario. The apothecary in the next room features a sink that Banting installed for his medical practice. Other galleries in the museum hold original belongings of Banting as well, most notably his desk and his bed frame. The bed frame is kept in Banting's bedroom, and visitors are encouraged to take a moment or a picture with it, as it is not roped off like many other areas of the museum. Additionally, an official replica of the Nobel Prize medal co-awarded to Banting and Macleod is on display, as well as many of Banting's other medals. Other displays include the military gallery, which includes a representation of the type of operating room Banting would have worked in on the field during the First World War, some information on the projects he headed during the Second World War, and an entire gallery filled with artwork done by Banting.

Five amino acids possess a charge at neutral pH. Often these side chains appear at the surfaces on proteins to enable their solubility in water, and side chains with opposite charges form important electrostatic contacts called salt bridges that maintain structures within a single protein or between interfacing proteins. Many proteins bind metal into their structures specifically, and these interactions are commonly mediated by charged side chains such as aspartate, glutamate and histidine. Under certain conditions, each ion-forming group can be charged, forming double salts. The two negatively charged amino acids at neutral pH are aspartate (Asp, D) and glutamate (Glu, E). The anionic carboxylate groups behave as Brønsted bases in most circumstances. Enzymes in very low pH environments, like the aspartic protease pepsin in mammalian stomachs, may have catalytic aspartate or glutamate residues that act as Brønsted acids.

Sources: en.wikipedia.org

Supporting material

Amanda Grace Paulovich is an oncologist, and a pioneer in proteomics using multiple reaction monitoring mass spectrometry to study tailored cancer treatment. Paulovich received a BS in Biological Sciences from Carnegie Mellon University in 1988, a PhD in Genetics from University of Washington in 1996, under the direction of Leland Hartwell. She also received a MD from University of Washington in 1998. Follow her residency in Internal Medicine at Massachusetts General Hospital, she also completed a Postdoctoral Fellowship in Computational Biology at the Massachusetts Institute of Technology Whitehead Center for Genomic Research in 2003, and a Fellowship in Medical Oncology at the Dana Farber Cancer Institute in 2004.

Antimicrobial peptides generally have a net positive charge, allowing them to interact with the negatively charged molecules exposed on bacteria and cancer cell surfaces, such as phospholipid phosphatidylserine, O-glycosylated mucins, sialylated gangliosides, and heparin sulfates. The mechanism of action of these peptides varies widely but can be simplified into two categories: membranolytic and non-membranolytic antimicrobial peptides. The disruption of membranes by membranolytic antimicrobial peptides can be described by four models:

In addition to Amazon Lockers, Amazon staffed around 30 pickup points in the US and over 800 independent points in India. US locations had large sets of Amazon Lockers and an area for customers to make returns. The India locations were in existing retailers where customers wait for a store employee to retrieve their package. Amazon launched its distribution network in 1997 with fulfillment centers in Seattle and New Castle, Delaware. Amazon has several types of distribution facilities including cross-dock centers, fulfillment centers, sorting centers, delivery stations, Prime now hubs, and Prime air hubs. As of 2018 the US had 75 fulfillment centers and 25 sorting centers with over 125,000 employees. Employees are responsible for:

Several approaches have been developed to analyze the location of organelles, genes, proteins, and other components within cells. A gene ontology category, cellular component, has been devised to capture subcellular localization in many biological databases. Microscopic pictures allow for the location of organelles as well as molecules, which may be the source of abnormalities in diseases. Finding the location of proteins allows us to predict what they do. This is called protein function prediction. For instance, if a protein is found in the nucleus it may be involved in gene regulation or splicing. By contrast, if a protein is found in mitochondria, it may be involved in respiration or other metabolic processes. There are well developed protein subcellular localization prediction resources available, including protein subcellular location databases, and prediction tools.

ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).

Sources: en.wikipedia.org

Frequently asked questions

What is whey protein hydrolysate made from?

It is made from whey, a byproduct of cheese or casein production, or from whey protein concentrate or isolate. Enzymes break the intact whey proteins into shorter peptides. The final composition depends on the starting whey and the hydrolysis conditions.

Is whey protein hydrolysate the same as whey protein isolate?

No. Whey protein isolate is a purified intact protein, while hydrolysate has been enzymatically cleaved into smaller peptides, and hydrolysate can be produced from isolate or concentrate. The two ingredients differ in molecular size, taste, and functional behavior.

Does hydrolysis remove lactose or milk allergens?

Hydrolysis cleaves proteins but does not necessarily remove lactose, which is a sugar. It can reduce the size of allergenic proteins, yet residual peptides may still trigger reactions in sensitive individuals. Allergen status depends on the extent of hydrolysis and must be assessed for each product.

How is peptide size measured in hydrolysate powders?

Peptide size is commonly estimated by size-exclusion chromatography, gel electrophoresis, or mass spectrometry. These techniques separate or identify molecules according to mass or hydrodynamic volume. Results depend on calibration and method conditions, so they are best compared within the same analytical protocol.

Network